missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AE2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92513-0.1ml
This item is not returnable.
View return policy
Description
AE2 Polyclonal antibody specifically detects AE2 in Human samples. It is validated for Western Blot
Specifications
| AE2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1). DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP | |
| 0.1 mL | |
| Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 6522 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction