missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Hexokinase 2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33349-100ul
This item is not returnable.
View return policy
Description
Hexokinase 2 Monoclonal antibody specifically detects Hexokinase 2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Hexokinase 2 | |
| Monoclonal | |
| Western Blot 1:5000 - 1:30000, ELISA Recommended starting concentration is 1 μg/mL | |
| DKFZp686M1669, EC 2.7.1, hexokinase 2, Hexokinase type II, HKII, HXK2, muscle, Muscle form hexokinase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase 2 (NP_000180.2).,, Sequence:, MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR | |
| 100 μL | |
| Cell Cycle and Replication | |
| 3099 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction