missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Zyxin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54751
This item is not returnable.
View return policy
Description
Zyxin Polyclonal specifically detects Zyxin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Zyxin | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CTCL tumor antigen se14-3, CTCL-associated antigen se14-3, cutaneous T-cell lymphoma associated antigen se14-3, Cutaneous T-cell lymphoma-associated antigen se14-3, KIAA1125, MGC31836, predicted protein of HQ2893, PRKCBP1, PRO2893, protein kinase C-binding protein 1, Rack7, RACK7protein kinase C binding protein 1, zinc finger MYND domain containing protein 8, Zinc finger MYND domain-containing protein 8, zinc finger, MYND-type containing 8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ZYX | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF | |
| 100 μL | |
| Signal Transduction | |
| 7791 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction