missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZnT-8/SLC30A8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | ZnT-8/SLC30A8 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18690437
|
Novus Biologicals
NBP2-62701-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661929
|
Novus Biologicals
NBP2-62701 |
100 μg |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZnT-8/SLC30A8 Polyclonal antibody specifically detects ZnT-8/SLC30A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ZnT-8/SLC30A8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 169026 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| solute carrier family 30 (zinc transporter), member 8, Solute carrier family 30 member 8, zinc transporter 8, zinc transporter ZnT-8, ZNT8ZnT-8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title