missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZnT-8/SLC30A8 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94810-0.02ml
This item is not returnable.
View return policy
Description
ZnT-8/SLC30A8 Polyclonal antibody specifically detects ZnT-8/SLC30A8 in Human, Mouse samples. It is validated for Western Blot
Specifications
| ZnT-8/SLC30A8 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| solute carrier family 30 (zinc transporter), member 8, Solute carrier family 30 member 8, zinc transporter 8, zinc transporter ZnT-8, ZNT8ZnT-8 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SLC30A8 (NP_776250.2). MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPTEKGANEYAYAKWKLC | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 169026 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction