missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ZNHIT1 Polyclonal specifically detects ZNHIT1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | ZNHIT1 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | CG1I, CGBP1, Cyclin-G1-binding protein 1, H_DJ0747G18.14, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger HIT domain-containing protein 1, Zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member 1, zinc finger, HIT domain containing 1, zinc finger, HIT type 1, zinc finger, HIT-type containing 1, ZNFN4A1 |
| Gene Symbols | ZNHIT1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?