missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF85 Antibody (4D12), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00007639-M04
This item is not returnable.
View return policy
Description
ZNF85 Monoclonal antibody specifically detects ZNF85 in Human samples. It is validated for Western Blot, ELISA
Specifications
| ZNF85 | |
| Monoclonal | |
| Unconjugated | |
| NP_003420 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 7639 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2b κ |
| Western Blot, ELISA | |
| 4D12 | |
| In 1x PBS, pH 7.4 | |
| HPF4, HTF1, MGC78566, zinc finger protein 85, zinc finger protein 85 (HPF4, HTF1), Zinc finger protein HPF4, Zinc finger protein HTF1 | |
| ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction