missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF547 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | ZNF547 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
ZNF547 Polyclonal specifically detects ZNF547 in Human samples. It is validated for Western Blot.Specifications
| ZNF547 | |
| Polyclonal | |
| Purified | |
| RUO | |
| EAW72498 | |
| 284306 | |
| Synthetic peptide directed towards the N terminal of human ZNF547. Peptide sequence GTHPEQGLYTCPAHLHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTF. | |
| Primary | |
| 38 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ31100, zinc finger protein 547 | |
| ZNF547 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title