missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF417 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | ZNF417 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF417 Polyclonal specifically detects ZNF417 in Human samples. It is validated for Western Blot.Specifications
| ZNF417 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MGC34079, zinc finger protein 417 | |
| ZNF417 | |
| IgG | |
| 66 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_689688 | |
| 147687 | |
| Synthetic peptide directed towards the N terminal of human ZNF417. Peptide Sequence: HQETHHKQKLNRSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVK | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title