missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ZNF207 Recombinant Protein

Name: Abnova&trade; ZNF207 Recombinant Protein
Brand: Abnova&trade;
SKU: 16102102
Price: 349.00 EUR

Brand: Abnova™ H00007756-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16102102

Quantity
Estimated Shipment: 07-07-2023
to see stock.

Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH02372
Format	Solution
Gene ID (Entrez)	7756
Name	ZNF207 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	ZNF207
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	76.67
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY
Gene Alias	DKFZp761N202
Gene Symbol	ZNF207
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description