missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ZNF174 Recombinant Protein
Brand: Abnova™ H00007727-P01.10ug
This item is not returnable.
View return policy
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH00876 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
51.48 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA | |
ZSCAN8 | |
ZNF174 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
7727 | |
ZNF174 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ZNF174 | |
Human | |
Recombinant | |
Solution |