missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZER1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
508.00€
Specifications
| Antigen | ZER1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZER1 Polyclonal specifically detects ZER1 in Human samples. It is validated for Western Blot.Specifications
| ZER1 | |
| Polyclonal | |
| Rabbit | |
| C9orf60, chromosome 9 open reading frame 60, homolog of Zyg-11, Hzygzyg-11 homolog B (C. elegans)-like, protein zer-1 homolog, zer-1 homolog (C. elegans), ZYG homolog, Zyg-11 homolog B-like protein, ZYG11BL, ZYGRP11-545E17.4 | |
| ZER1 | |
| IgG | |
| 88 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 10444 | |
| Synthetic peptides corresponding to ZER1 (zer-1 homolog (C. elegans)) The peptide sequence was selected from the middle region of ZER1. Peptide sequence LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title