missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ZDHHC5 Polyclonal antibody specifically detects ZDHHC5 in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | ZDHHC5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | DHHC domain containing 5, DKFZp586K0524, zinc finger, DHHC-type containing 5, ZNF375 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 130-230 of human ZDHHC5 (NP_056272.2). FDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?