missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC18 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94111-0.1ml
This item is not returnable.
View return policy
Description
ZDHHC18 Polyclonal antibody specifically detects ZDHHC18 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ZDHHC18 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| DHHC domain containing 18, DHHC18, DHHC-18, EC 2.3.1, EC 2.3.1.-, zinc finger, DHHC-type containing 18 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 301-388 of human ZDHHC18 (NP_115659.1). YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 84243 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction