missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WSTF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57741-25ul
Les retours ne sont pas autorisés pour ce produit.
Consulta la politica di reso
Descrizione
WSTF Polyclonal specifically detects WSTF in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifica
| WSTF | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| bromodomain adjacent to zinc finger domain, 1B, williams-Beuren syndrome chromosomal region 10 protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| BAZ1B | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE | |
| 25 μL | |
| Transcription Factors and Regulators | |
| 9031 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto