missing translation for 'onlineSavingsMsg'
Learn More

Wee1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand: Novus Biologicals NBP3-33344-20ul

View more versions of this product

Product Code. 30228315

213.00€ / 20µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Wee1 Monoclonal antibody specifically detects Wee1 in Mouse samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)

Specifications

Antigen	Wee1
Classification	Monoclonal
Dilution	ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	DKFZp686I18166, EC 2.7.10.2, FLJ16446, WEE1 homolog (S. pombe), wee1+ (S. pombe) homolog, WEE1+ homolog, WEE1A, Wee1A kinase, WEE1hu, wee1-like protein kinase
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Wee1 (NP_003381.1).,, Sequence:, MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACP
Quantity	20 μL
Research Discipline	Cell Cycle and Replication, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Phospho Specific, Stem Cell Markers
Gene ID (Entrez)	7465
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Mouse
Form	Purified

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Wee1 Antibody, Novus Biologicals™

Description

Specifications

Produktvorschläge

Dokumentation

Aktionen