missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VISTA/B7-H5/PD-1H Antibody (CL3975), Novus Biologicals™
Mouse Monoclonal Antibody
369.00€ - 513.00€
Specifications
| Antigen | VISTA/B7-H5/PD-1H |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18044044
|
Novus Biologicals
NBP2-59030 |
100 μL |
513.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664478
|
Novus Biologicals
NBP2-59030-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VISTA/B7-H5/PD-1H Monoclonal specifically detects VISTA/B7-H5/PD-1H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| VISTA/B7-H5/PD-1H | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| 64115 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| Mouse | |
| Cancer, Cardiovascular Biology, Immunology | |
| B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR | |
| C10ORF54 | |
| IgG1 | |
| Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title