missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ VGLL1 Recombinant Protein

Name: Abnova&trade; VGLL1 Recombinant Protein
Brand: Abnova&trade;
SKU: 16100033
Price: 349.00 EUR

Brand: Abnova™ H00051442-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16100033

Quantity
Estimated Shipment: 07-07-2023
to see stock.

Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH03362
Format	Solution
Gene ID (Entrez)	51442
Name	VGLL1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	VGLL1
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	54.12
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSISPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYLQHL
Gene Alias	TDU/VGL1
Gene Symbol	VGLL1
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description