missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VAMP3/Cellubrevin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38430-20ul
This item is not returnable.
View return policy
Description
VAMP3/Cellubrevin Polyclonal antibody specifically detects VAMP3/Cellubrevin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| VAMP3/Cellubrevin | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CEBCellubrevin, cellubrevin, SYB3, Synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human VAMP3/Cellubrevin (NP_004772.1).,, Sequence:, MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWA | |
| 20 μL | |
| Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neurotransmission | |
| 9341 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction