missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VAChT/SLC18A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00€ - 584.00€
Specifications
| Antigen | VAChT/SLC18A3 |
|---|---|
| Dilution | ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228278
|
Novus Biologicals
NBP3-35635-20ul |
20 μL |
214.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231410
|
Novus Biologicals
NBP3-35635-100ul |
100 μL |
584.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VAChT/SLC18A3 Polyclonal antibody specifically detects VAChT/SLC18A3 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| VAChT/SLC18A3 | |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| ABC Transporters, Neuronal Cell Markers, Neuroscience | |
| PBS (pH 7.3), 50% glycerol | |
| 6572 | |
| IgG | |
| Affinity purified |
| ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| MGC12716, solute carrier family 18 (vesicular acetylcholine), member 3, Solute carrier family 18 member 3, solute carrier family 18, member 3, VAChT, VACHTvesicular acetylcholine transporter | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human VAChT/SLC18A3 (NP_003046.2).,, Sequence:, GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title