missing translation for 'onlineSavingsMsg'
Learn More
Learn More
V1a Vasopressin R/AVPR1A Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94637-0.1ml
This item is not returnable.
View return policy
Description
V1a Vasopressin R/AVPR1A Polyclonal antibody specifically detects V1a Vasopressin R/AVPR1A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| V1a Vasopressin R/AVPR1A | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Antidiuretic hormone receptor 1a, arginine vasopressin receptor 1A, AVPR V1a, AVPR1, SCCL vasopressin subtype 1a receptor, V1a vasopressin receptor, V1aR, V1-vascular vasopressin receptor AVPR1A, Vascular/hepatic-type arginine vasopressin receptor, vasopressin V1a receptor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human V1a Vasopressin R/AVPR1A (NP_000697.1). MFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST | |
| 0.1 mL | |
| GPCR | |
| 552 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction