missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP33 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35652-100ul
This item is not returnable.
View return policy
Description
USP33 Polyclonal antibody specifically detects USP33 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| USP33 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Deubiquitinating enzyme 33, EC 3.1.2.15, EC 3.4.19.12, hVDU1, KIAA1097MGC16868, pVHL-interacting deubiquitinating enzyme 1, ubiquitin carboxyl-terminal hydrolase 33, ubiquitin specific peptidase 33, ubiquitin thioesterase 33, Ubiquitin thiolesterase 33, Ubiquitin-specific-processing protease 33, VDU1ubiquitin specific protease 33, VHL-interacting deubiquitinating enzyme 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human USP33 (NP_963920.1).,, Sequence:, QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETV | |
| 100 μL | |
| Protein Turnover, Ubiquitin Proteasome Pathway | |
| 23032 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction