missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ULK1 Polyclonal antibody specifically detects ULK1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | ULK1 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | ATG1, ATG1 autophagy related 1 homolog, ATG1A, EC 2.7.11, EC 2.7.11.1, FLJ38455, FLJ46475, KIAA0722, serine/threonine-protein kinase ULK1, UNC51, unc-51 (C. elegans)-like kinase 1, Unc51.1, Unc-51-like kinase 1, unc-51-like kinase 1 (C. elegans) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ULK1 (NP_003556.1). SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?