missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UGT3A1 Polyclonal specifically detects UGT3A1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | UGT3A1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | EC 2.4.1, EC 2.4.1.17, FLJ26528, FLJ34658, UDP glycosyltransferase 3 family, polypeptide A1, UDP-glucuronosyltransferase 3A1, UDPGT 3A1 |
| Gene Symbols | UGT3A1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?