missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UCP3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94835-0.02ml
This item is not returnable.
View return policy
Description
UCP3 Polyclonal antibody specifically detects UCP3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| UCP3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| mitochondrial uncoupling protein 3, SLC25A9Solute carrier family 25 member 9, UCP 3, uncoupling protein 3 (mitochondrial, proton carrier), Uncoupling protein-3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-119 of human UCP3 (NP_073714.1). AGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTR | |
| 0.02 mL | |
| Cancer, Cardiovascular Biology, Diabetes Research, Endocrinology, metabolism, Neuroscience, Signal Transduction | |
| 7352 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction