missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TYW1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Specifications
| Antigen | TYW1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18225823
|
Novus Biologicals
NBP2-58222 |
100 μL |
 624.00€ 590.10€ / 100µL Save 33.90€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18689088
|
Novus Biologicals
NBP2-58222-25ul |
25 μL |
415.00€ 391.65€ / 25µL Save 23.35€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
TYW1 Polyclonal specifically detects TYW1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Tekniske data
| TYW1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55253 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| FLJ10900, MGC23001, MGC60291, Radical S-adenosyl methionine and flavodoxin domain-containing protein 1, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD1, tRNA wybutosine-synthesizing protein 1 homolog, tRNA-yW synthesizing protein 1 homolog (S. cerevisiae), tRNA-yW synthesizing protein 1 homolog A, tRNA-yW-synthesizing protein, TYW1A, YPL207W | |
| TYW1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel