missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TTC23L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | TTC23L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TTC23L Polyclonal specifically detects TTC23L in Human samples. It is validated for Western Blot.Specifications
| TTC23L | |
| Polyclonal | |
| Rabbit | |
| Q6PF05 | |
| 153657 | |
| Synthetic peptides corresponding to FLJ25439 The peptide sequence was selected from the N terminal of FLJ25439. Peptide sequence MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ25439, tetratricopeptide repeat domain 23-like, tetratricopeptide repeat protein 23-like | |
| TTC23L | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title