missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TSPAN17 Polyclonal antibody specifically detects TSPAN17 in Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | TSPAN17 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:200-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | F-box only protein 23, FBXO23, MGC14859, MGC71255, Tetraspan protein SB134, tetraspanin 17, tetraspanin-17, TM4SF17, transmembrane 4 superfamily member 17, Tspan-17 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 116-234 of human TSPAN17 (NP_001006617.2). VFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?