missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSFM Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93796-0.02ml
This item is not returnable.
View return policy
Description
TSFM Polyclonal antibody specifically detects TSFM in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| TSFM | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 | |
| COXPD3, EF-Ts, EFTS, EF-TsMt, EFTSMT, mitochondrial, mitochondrial elongation factor Ts, Ts translation elongation factor, mitochondrial | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167.1). PSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE | |
| 0.02 mL | |
| Endocrinology | |
| 10102 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction