missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRPM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | TRPM1 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TRPM1 Polyclonal specifically detects TRPM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TRPM1 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| CSNB1C, Long transient receptor potential channel 1, LTrpC1, LTRPC1transient receptor potential cation channel subfamily M member 1, melastatin 1, melastatin-1, MLSN, MLSN1transient receptor potential melastatin family, transient receptor potential cation channel, subfamily M, member 1 | |
| TRPM1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 4308 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title