missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TrpC2-like protein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | TrpC2-like protein |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18240404
|
Novus Biologicals
NBP2-58169 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604586
|
Novus Biologicals
NBP2-58169-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TrpC2-like protein Polyclonal specifically detects TrpC2-like protein in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TrpC2-like protein | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 100133315 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFLQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| LOC100133315 transient receptor potential cation channel, subfamily C, member 2-like | |
| LOC100133315 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title