missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TrkC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | TrkC |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18234024
|
Novus Biologicals
NBP2-58383 |
100 μL |
529.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18655676
|
Novus Biologicals
NBP2-58383-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TrkC Polyclonal specifically detects TrkC in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TrkC | |
| Polyclonal | |
| Rabbit | |
| Cancer, Protein Kinase | |
| EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3 growth factor receptor, Trk-C, TrkC tyrosine kinase, TRKCneurotrophin 3 receptor, tyrosine kinase receptor C | |
| NTRK3 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4916 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title