missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM60 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | TRIM60 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRIM60 Polyclonal specifically detects TRIM60 in Human samples. It is validated for Western Blot.Specifications
| TRIM60 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| Q495X7 | |
| 166655 | |
| Synthetic peptides corresponding to TRIM60(tripartite motif-containing 60) The peptide sequence was selected from the N terminal of TRIM60. Peptide sequence LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ35882, RING finger protein 129MGC119325, RING finger protein 33, RNF129, RNF33, tripartite motif containing 60, tripartite motif-containing 60, tripartite motif-containing protein 60 | |
| TRIM60 | |
| IgG | |
| 55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title