missing translation for 'onlineSavingsMsg'
Learn More

TRIM56 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-80829-25ul

View more versions of this product

Product Code. 18446920

292.00€ / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

TRIM56 Polyclonal antibody specifically detects TRIM56 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen	TRIM56
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.	Q9BRZ2
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol
Gene Alias	DKFZp667O116, E3 ubiquitin-protein ligase TRIM56, EC 6.3.2.-, RING finger protein 109, RNF109FLJ35608, tripartite motif containing 56, tripartite motif-containing 56, Tripartite motif-containing protein 56
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: PECRETVPVPPEGVASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRC
Quantity	25 μL
Research Discipline	Zinc Finger
Gene ID (Entrez)	81844
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

TRIM56 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions