missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIB3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33528-100ul
This item is not returnable.
View return policy
Description
TRIB3 Monoclonal antibody specifically detects TRIB3 in Human samples. It is validated for ELISA,Western Blot
Specifications
| TRIB3 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| C20orf97, dJ1103G7.3, neuronal cell death inducible putative kinase, Neuronal cell death-inducible putative kinase, NIPK, p65-interacting inhibitor of NF-kappaB, p65-interacting inhibitor of NF-kappa-B, SINK, SKIP3, TRB-3, TRB3chromosome 20 open reading frame 97, tribbles homolog 3, tribbles homolog 3 (Drosophila) | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRIB3(Q96RU7),, Sequence:, MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGG | |
| 100 μL | |
| Apoptosis, Cancer, Hypoxia | |
| 57761 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction