missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAP alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
353.00€ - 557.00€
Specifications
| Antigen | TRAP alpha |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18434211
|
Novus Biologicals
NBP1-86912-25ul |
25 μL |
353.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18231317
|
Novus Biologicals
NBP1-86912 |
0.1 mL |
557.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TRAP alpha Polyclonal specifically detects TRAP alpha in Human, Mouse, Rat, C. elegans samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TRAP alpha | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6745 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat, C. elegans | |
| DKFZp781N23103, FLJ14232, FLJ22100, FLJ23034, FLJ78242, FLJ93042, signal sequence receptor, alpha, SSR alpha subunit, SSR-alpha, translocon-associated protein alpha subunit, translocon-associated protein subunit alpha, TRAP alpha, TRAP-alpha, TRAPASignal sequence receptor subunit alpha | |
| SSR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human TRAP alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title