missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TMEPAI Antibody, R&D Systems™

TMEPAI Antibody, R&D Systems™

Product Code. 18600439 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18600439 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18600439 Supplier Novus Biologicals Supplier No. NBP25665725ul
 Restricted Item
Estimated Shipment: 03-12-2026
Add to basket
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

TMEPAI Polyclonal specifically detects TMEPAI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen TMEPAI
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias prostate transmembrane protein, androgen induced 1, Solid tumor-associated 1 protein, STAG1prostate androgen induced RNA, transmembrane prostate androgen-induced protein
Gene Symbols PMEPA1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 56937
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.