missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEPAI Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | TMEPAI |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEPAI Polyclonal specifically detects TMEPAI in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| TMEPAI | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 56937 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| prostate transmembrane protein, androgen induced 1, Solid tumor-associated 1 protein, STAG1prostate androgen induced RNA, transmembrane prostate androgen-induced protein | |
| PMEPA1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title