missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | TMEM18 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232565
|
Novus Biologicals
NBP3-35869-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227026
|
Novus Biologicals
NBP3-35869-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM18 Polyclonal antibody specifically detects TMEM18 in Human,Rat samples. It is validated for ELISA,Western BlotSpecifications
| TMEM18 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Rat | |
| transmembrane protein 18 | |
| A synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2).,, Sequence:, LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 129787 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title