missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM104 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | TMEM104 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
TMEM104 Polyclonal specifically detects TMEM104 in Human samples. It is validated for Western Blot.Specifications
| TMEM104 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ00021, FLJ20255, transmembrane protein 104 | |
| TMEM104 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q8NE00-2 | |
| 54868 | |
| Synthetic peptides corresponding to TMEM104(transmembrane protein 104) The peptide sequence was selected from the middle region of TMEM104. Peptide sequence GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title