missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
TLR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00€ - 498.00€
Tekniske data
| Antigen | TLR4 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18180928
|
Novus Biologicals
NBP2-47604 |
0.1 mL |
498.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18654506
|
Novus Biologicals
NBP2-47604-25ul |
25 μL |
302.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
TLR4 Polyclonal specifically detects TLR4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| TLR4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| ARMD10, CD284, CD284 antigen, hTollhomolog of Drosophila toll, TOLL, toll-like receptor 4 | |
| TLR4 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Signal Transduction, Toll Like Receptors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7099 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel