missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TLK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35473-20ul
This item is not returnable.
View return policy
Description
TLK1 Polyclonal antibody specifically detects TLK1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| TLK1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| EC 2.7.11, EC 2.7.11.1, KIAA0137serine/threonine-protein kinase tousled-like 1, PKU-beta, SNARE protein kinase SNAK, tousled-like kinase 1serine threonine protein kinase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3).,, Sequence:, PVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ | |
| 20 μL | |
| Apoptosis, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Repair, Tumor Suppressors | |
| 9874 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction