missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tissue alpha-L-Fucosidase/FUCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57993
This item is not returnable.
View return policy
Description
Tissue alpha-L-Fucosidase/FUCA1 Polyclonal specifically detects Tissue alpha-L-Fucosidase/FUCA1 in Human samples. It is validated for Western Blot.
Specifications
| Tissue alpha-L-Fucosidase/FUCA1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Chicken: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Xenopus: 85%; Rabbit: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P04066 | |
| FUCA1 | |
| Synthetic peptides corresponding to FUCA1(fucosidase, alpha-L- 1, tissue) The peptide sequence was selected from the middle region of FUCA1. Peptide sequence TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL. | |
| 100 μL | |
| Signal Transduction | |
| 2517 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction