missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Product Code. 18708203 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
5 mg
Unit Size:
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18708203 - -
18467731 5 mg 5mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”27950” to get your promotional price
Product Code. 18708203 Supplier Novus Biologicals™ Supplier No. NBP226245
  • ONLINE EXCLUSIVE PRICE
    705.00€
    666.75€ / 1mg
    Save 38.25€
    5% Off
View all promotions
 Restricted Item
Estimated Shipment: 28-09-2026
Add to basket
470.00 EUR valid until 2026-09-30
BEST PRICE on Promo! Use promo code "27950" to get your promotional price.
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”27950” to get your promotional price

Description

Applications: Flow Cytometry, In vitro assay

TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da

TRUSTED_SUSTAINABILITY

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.