missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIP60 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93320-0.1ml
This item is not returnable.
View return policy
Description
TIP60 Polyclonal antibody specifically detects TIP60 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| TIP60 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| cPLA2, ESA1EC 2.3.1.48, Histone acetyltransferase HTATIP, histone acetyltransferase KAT5, HIV-1 Tat interactive protein, HIV-1 Tat interactive protein, 60kDa, HTATIP1, HTATIPcPLA2 interacting protein, K(lysine) acetyltransferase 5,60 kDa Tat-interactive protein, K-acetyltransferase 5, Lysine acetyltransferase 5, PLIPTIP, Tat interacting protein, 60kDa, Tip60, TIP60cPLA(2)-interacting protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 182-282 of human TIP60 (NP_006379.2). AQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTK | |
| 0.1 mL | |
| Apoptosis, DNA Repair | |
| 10524 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction