missing translation for 'onlineSavingsMsg'
Learn More
Learn More
THAP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Specifications
| Antigen | THAP3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
THAP3 Polyclonal specifically detects THAP3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| THAP3 | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| MGC33488, THAP domain containing, apoptosis associated protein 3, THAP domain-containing protein 3 | |
| THAP3 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 90326 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title