missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEX101 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
221.00€ - 470.00€
Specifications
| Antigen | TEX101 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18680512
|
Novus Biologicals
NBP2-94471-0.02ml |
0.02 mL |
221.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651722
|
Novus Biologicals
NBP2-94471-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TEX101 Polyclonal antibody specifically detects TEX101 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TEX101 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.3), 50% glycerol | |
| 83639 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| cancer/testis antigen 131, Cell surface receptor NYD-SP8, CT131, MGC4766, NYD-SP8, PRO1884, Scleroderma-associated autoantigen, SGRGGTPR867, Spermatogenesis-related gene protein, TES101RP, testis expressed 101, testis expressed sequence 101, testis-expressed protein 101, testis-specific protein TES101RP | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4). LYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTAS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title