missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCP1 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88149
This item is not returnable.
View return policy
Description
TCP1 alpha Polyclonal antibody specifically detects TCP1 alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| TCP1 alpha | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CCT1T-complex protein 1 subunit alpha, CCTa, CCT-alpha, D6S230E, tailless complex polypeptide 1, t-complex 1, T-complex protein 1, alpha subunit, TCP-1-alpha | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY | |
| 0.1 mL | |
| Cancer, Hypoxia, Membrane Trafficking and Chaperones, Stem Cell Markers | |
| 6950 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction