missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TCEB1 Recombinant Protein
Brand: Abnova™ H00006921-P01.10ug
Additional Details : Weight : 0.00010kg
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH13809 | |
Solution | |
6921 | |
TCEB1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TCEB1 | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
38.06 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC | |
SIII | |
TCEB1 | |
Wheat Germ (in vitro) | |
GST |