missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBLR1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94126-0.1ml
This item is not returnable.
Rückgaberichtlinie anzeigen
Beschreibung
TBLR1 Polyclonal antibody specifically detects TBLR1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Spezifikation
| TBLR1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| C21, DC42, F-box-like/WD repeat-containing protein TBL1XR1, FLJ12894, IRA1Transducin beta-like 1X-related protein 1, nuclear receptor co-repressor/HDAC3 complex subunit, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBLR1TBL1-related protein 1, transducin (beta)-like 1 X-linked receptor 1, transducin (beta)-like 1X-linked receptor 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBLR1 (NP_078941.2). QQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHES | |
| 0.1 mL | |
| Wnt Signaling Pathway | |
| 79718 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur